PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G271800.1.p
Common NameLOC101764115, SETIT_018252mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 233aa    MW: 23905.1 Da    PI: 9.8464
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G271800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.91.1e-25136180145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         ++epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  Seita.1G271800.1.p 136 EPEPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 180
                         69****************************************985 PP

2QLQ53.28.8e-1970106137
                 QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                         sa+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  Seita.1G271800.1.p  70 SALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 106
                         799*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.5E-670106IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.22571106IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.5E-1171105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.701136180IPR014977WRC domain
PfamPF088793.3E-21137179IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MAEDKETDSP QPPAKLPRLS CADTSAGEVT MAASSPLVLG LGLGLGAGGG GGGERDGEAS  60
AATAAPKRAS ALTFMQQQEL EHQVLIYRYF AAGAPVPVHL VLPIWKSVAA SSFGPQRFPS  120
LVGLGSLCFD YRSSMEPEPG RCRRTDGKKW RCSRDVVPGH KYCERHVHRG RGRSRKPVEA  180
ASAAAPPPTA AAAAVSSSRG GAPVAHHGGA APHGLGFSPT SVLLAHSAAR AT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278570.0KJ727857.1 Zea mays clone pUT5948 GRF transcription factor (GRF9) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955149.11e-166PREDICTED: growth-regulating factor 10-like
SwissprotQ6EPP92e-98GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLK3YVF61e-166K3YVF6_SETIT; Uncharacterized protein
STRINGSi018252m1e-165(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62213051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.12e-36growth-regulating factor 3